Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQE ELLSSQVTQEL RALMDETMKELKAYKSELEEQLTPVAEETRARLSKEL QAAQARLGADMEDVCGRLVQYRGEV QAMLGQSTEELRVRLASHLRKLR KRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLV EQGRVRAA TVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKL EEQ AQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSA APVPSDNH
    • Molecular weight

      34 kDa including tags
    • Amino acids

      19 to 317

Specifications

Our Abpromise guarantee covers the use of ab123764 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Purity

    > 90 % SDS-PAGE.
    Purity is greater than 90% as determined by HPLC and SDS-PAGE.
  • Form

    Lyophilised
  • Additional notes

    Endotoxin Level: <0.1 ng/µg.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Store under desiccating conditions.

    Constituent: 0.28% Sodium phosphate

  • Reconstitution
    Reconstitute in dH2O to a concentration of 0.1-1.0 mg/ml. The solution can then be diluted into other aqueous buffers and store at 4°C for 1 week or –20°C for future use.

General Info

  • Alternative names

    • AD2
    • Apo-E
    • APOE
    • APOE_HUMAN
    • APOE3
    • ApoEb
    • Apolipoprotein E
    • Apoprotein
    see all
  • Function

    Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.
  • Tissue specificity

    Occurs in all lipoprotein fractions in plasma. It constitutes 10-20% of very low density lipoproteins (VLDL) and 1-2% of high density lipoproteins (HDL). APOE is produced in most organs. Significant quantities are produced in liver, brain, spleen, lung, adrenal, ovary, kidney and muscle.
  • Involvement in disease

    Defects in APOE are a cause of hyperlipoproteinemia type 3 (HLPP3) [MIM:107741]; also known as familial dysbetalipoproteinemia. Individuals with HLPP3 are clinically characterized by xanthomas, yellowish lipid deposits in the palmar crease, or less specific on tendons and on elbows. The disorder rarely manifests before the third decade in men. In women, it is usually expressed only after the menopause. The vast majority of the patients are homozygous for APOE*2 alleles. More severe cases of HLPP3 have also been observed in individuals heterozygous for rare APOE variants. The influence of APOE on lipid levels is often suggested to have major implications for the risk of coronary artery disease (CAD). Individuals carrying the common APOE*4 variant are at higher risk of CAD.
    Genetic variations in APOE are associated with Alzheimer disease type 2 (AD2) [MIM:104310]. It is a late-onset neurodegenerative disorder characterized by progressive dementia, loss of cognitive abilities, and deposition of fibrillar amyloid proteins as intraneuronal neurofibrillary tangles, extracellular amyloid plaques and vascular amyloid deposits. The major constituent of these plaques is the neurotoxic amyloid-beta-APP 40-42 peptide (s), derived proteolytically from the transmembrane precursor protein APP by sequential secretase processing. The cytotoxic C-terminal fragments (CTFs) and the caspase-cleaved products such as C31 derived from APP, are also implicated in neuronal death. Note=The APOE*4 allele is genetically associated with the common late onset familial and sporadic forms of Alzheimer disease. Risk for AD increased from 20% to 90% and mean age at onset decreased from 84 to 68 years with increasing number of APOE*4 alleles in 42 families with late onset AD. Thus APOE*4 gene dose is a major risk factor for late onset AD and, in these families, homozygosity for APOE*4 was virtually sufficient to cause AD by age 80. The mechanism by which APOE*4 participates in pathogenesis is not known.
    Defects in APOE are a cause of sea-blue histiocyte disease (SBHD) [MIM:269600]; also known as sea-blue histiocytosis. This disorder is characterized by splenomegaly, mild thrombocytopenia and, in the bone marrow, numerous histiocytes containing cytoplasmic granules which stain bright blue with the usual hematologic stains. The syndrome is the consequence of an inherited metabolic defect analogous to Gaucher disease and other sphingolipidoses.
    Defects in APOE are a cause of lipoprotein glomerulopathy (LPG) [MIM:611771]. LPG is an uncommon kidney disease characterized by proteinuria, progressive kidney failure, and distinctive lipoprotein thrombi in glomerular capillaries. It mainly affects people of Japanese and Chinese origin. The disorder has rarely been described in Caucasians.
  • Sequence similarities

    Belongs to the apolipoprotein A1/A4/E family.
  • Post-translational
    modifications

    Synthesized with the sialic acid attached by O-glycosidic linkage and is subsequently desialylated in plasma. O-glycosylated with core 1 or possibly core 8 glycans. Thr-307 is a minor glycosylation site compared to Ser-308.
    Glycated in plasma VLDL of normal subjects, and of hyperglycemic diabetic patients at a higher level (2-3 fold).
    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE (12%) of rh ApoE3 with ab123764

    Lane 1: MW Markers
    Lane 2: rh APO E-3 (1.65 ug)
    Lane 3: rh APO E-3 (3.3 ug)
    Lane 4: rh APO E-3 (6.6 ug)

References

This product has been referenced in:

  • Robert J  et al. Clearance of beta-amyloid is facilitated by apolipoprotein E and circulating high-density lipoproteins in bioengineered human vessels. Elife 6:N/A (2017). Read more (PubMed: 28994390) »
See 1 Publication for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

Thank you for your enquiry regarding ab123764.
We well this product in lyophilised form (100 µg in each tube) and the concentration reconstitution dependent. As our on-line product datasheet suggests we advise to reconstitute in 5 mM Sodium Phosphate pH 7.8 + 0.5 mM DTT to a concentration of 0.1-1.0 mg/ml. The solution can then be diluted into other aqueous buffers and stored at 4°C for 1 week or –20°C for future use.
If you need any further assistance in the future, please do not hesitate to contact me.

Read More

Answer

Thank you very much for your interest in ab123764.
I can confirm that functional studies are included on the datasheet and therefore this is not eligible for the Abtrial program.
We do not currently have an image of ab123764 in a functional study.
Simply follow these easy steps below to apply for our AbTrial Program:
1. Reply to this email, letting us know you are interested in testing this product before you purchase.
2. Our scientists will email you an inactive personal discount code for the value of the product.
3. Purchase and test the product at the regular price.
4. Submit an Abreview with an image of your results, including your discount code in the additional notes section of your Abreview.
5. Once the Abreview is submitted, the discount code will become active.
6. Apply your discount code on a future order within the expire date of the code order to receive that value off.
Please let me know if you have any questions about this offer and I would be happy to help you further.
The Terms and Conditions of this offer can be found at: www.abcam.com/abtrial.
This offer is only valid for one vial.
If you are interested in buying more vials, we can offer bulk discounts from five vials.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up