Description

  • Product name

    Recombinant Human Apolipoprotein L 4
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSWVQLITSVGTSGLFLGVRVREEGAGMRCSKTIQAGQWLDSSKGPLGP SPPPVPTAGYSSSFCVHYVNLLPGVLVLSVTSQYPHLSMALCQLAAHDWP RLSCVCV
    • Amino acids

      1 to 107
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164300 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • APOL IV
    • ApoL-IV
    • APOL4
    • APOL4_HUMAN
    • Apolipoprotein L IV
    • Apolipoprotein L-IV
    • Apolipoprotein L4
    • APOLIV
    • CTA 212A2.2
    • OTTHUMP00000028937
    see all
  • Function

    May play a role in lipid exchange and transport throughout the body. May participate in reverse cholesterol transport from peripheral cells to the liver.
  • Tissue specificity

    Widely expressed; the highest levels are in spinal cord, placenta, adrenal gland; also detected in spleen, bone marrow, uterus, trachea, mammary gland and testis; levels are low in brain, heart and pancreas.
  • Sequence similarities

    Belongs to the apolipoprotein L family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab164300 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164300 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164300.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up