Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP HVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIK ALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLP LHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARV QFKTYPGVMHSSCPQEMAAVKEFLEKLLPPVLEHHHHHH
    • Molecular weight
      26 kDa including tags
    • Amino acids
      1 to 231
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173050 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Additional notes

    Protein previously labeled as LYPLA2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.24% Tris, 0.02% DTT, 0.58% Sodium chloride

General Info

  • Alternative names
    • Acyl protein thioesterase
    • Acyl protein thioesterase 2
    • Acyl-protein thioesterase 2
    • APT 2
    • APT-2
    • APT2
    • DJ886K2.4
    • EC 3.1.2.-
    • LPL I
    • LPL II
    • LPL-II
    • LYPA2_HUMAN
    • LYPLA 2
    • Lypla2
    • Lysophospholipase II
    • LysoPLA II
    • OTTHUMP00000002999
    • OTTHUMP00000044831
    see all
  • Function
    May hydrolyze fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has lysophospholipase activity (By similarity). Deacylates GAP43.
  • Sequence similarities
    Belongs to the AB hydrolase superfamily. AB hydrolase 2 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab173050 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173050.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up