Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNV KVSLAFGLSIATLAQSVGHISGAHL NPAVTLGLLLSCQISIFRALMYI IAQCVGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLGIEIIGTLQ LV LCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARS FGSAVITHNFSNHWIFWVGPFIGGALAVL IYDFILAPRSSDLTDRVKV WTSGQVEEYDLDADDINSRVEMKPK
    • Molecular weight

      56 kDa including tags
    • Amino acids

      1 to 269

Specifications

Our Abpromise guarantee covers the use of ab114210 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AQP 1
    • AQP CHIP
    • AQP-1
    • AQP1
    • AQP1_HUMAN
    • aquaporin 1 (channel-forming integral protein, 28kDa, CO blood group)
    • aquaporin 1 (Colton blood group)
    • Aquaporin CHIP
    • Aquaporin-1
    • Aquaporin-CHIP
    • Aquaporin1
    • Channel forming integral protein 28kDa
    • Channel like integral membrane protein 28 kDa
    • CHIP 28
    • CHIP28
    • CO
    • Colton blood group
    • Growth factor induced delayed early response protein
    • MGC26324
    • Urine water channel
    • Water channel protein CHIP 29
    • Water channel protein CHIP29
    • Water channel protein for red blood cells and kidney proximal tubule
    see all
  • Function

    Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
  • Tissue specificity

    Expressed in a number of tissues including erythrocytes, renal tubules, retinal pigment epithelium, heart, lung, skeletal muscle, kidney and pancreas. Weakly expressed in brain, placenta and liver.
  • Sequence similarities

    Belongs to the MIP/aquaporin (TC 1.A.8) family.
  • Domain

    Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab114210 stained with Coomassie Blue.

References

This product has been referenced in:

  • Zeming KK  et al. Fluorescent label-free quantitative detection of nano-sized bioparticles using a pillar array. Nat Commun 9:1254 (2018). Read more (PubMed: 29593276) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114210.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up