Overview

  • Product name

    Recombinant Human Aquaporin 2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGL GIGTLVQALGHISGAHINPAVTVACLVGCHVSVLRAAFYVAAQLLGAVAG AALLHEITPADIRGDLAVNALSNSTTAGQAVTVELFLTLQLVLCIFASTD ERRGENPGTPALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGKFDD HWVFWIGPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGLEPDTDWEERE VRRRQSVELHSPQSLPRGTKA
    • Molecular weight

      55 kDa including tags
    • Amino acids

      1 to 271

Specifications

Our Abpromise guarantee covers the use of ab152191 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ADH water channel
    • AQP 2
    • AQP CD
    • AQP-2
    • AQP-CD
    • AQP2
    • AQP2_HUMAN
    • AQPCD
    • Aquaporin 2 collecting duct
    • Aquaporin CD
    • Aquaporin-2
    • Aquaporin-CD
    • Aquaporin2
    • Aquaporine 2
    • Collecting duct water channel protein
    • MGC34501
    • Water channel aquaporin 2
    • Water channel protein for renal collecting duct
    • WCH CD
    • WCH-CD
    • WCHCD
    see all
  • Function

    Forms a water-specific channel that provides the plasma membranes of renal collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
  • Tissue specificity

    Expressed in renal collecting tubules.
  • Involvement in disease

    Diabetes insipidus, nephrogenic, autosomal
  • Sequence similarities

    Belongs to the MIP/aquaporin (TC 1.A.8) family.
  • Domain

    Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).
  • Post-translational
    modifications

    Ser-256 phosphorylation is necessary and sufficient for expression at the apical membrane. Endocytosis is not phosphorylation-dependent.
  • Cellular localization

    Apical cell membrane. Basolateral cell membrane. Cytoplasmic vesicle membrane. Golgi apparatus, trans-Golgi network membrane. Shuttles from vesicles to the apical membrane. Vasopressin-regulated phosphorylation is required for translocation to the apical cell membrane. PLEKHA8/FAPP2 is required to transport AQP2 from the TGN to sites where AQP2 is phosphorylated.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152191 stained with Coomassie Blue.

References

ab152191 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152191.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up