Description

  • Product name

    Recombinant Human Aquaporin 4 protein (Tagged)
    See all Aquaporin 4 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVI DVDRGEEKKGKDQSGEVLSSV
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      253 to 323
    • Tags

      His tag N-Terminus
    • Additional sequence information

      6xHis-SUMO tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab225651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • AQP 4
    • AQP-4
    • AQP4
    • AQP4_HUMAN
    • Aquaporin type 4
    • Aquaporin-4
    • Aquaporin4
    • HMIWC 2
    • HMIWC2
    • Mercurial insensitive water channel
    • Mercurial-insensitive water channel
    • MGC22454
    • MIWC
    • WCH 4
    • WCH4
    see all
  • Function

    Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.
  • Tissue specificity

    Brain - muscle >> heart, kidney, lung, and trachea.
  • Sequence similarities

    Belongs to the MIP/aquaporin (TC 1.A.8) family.
  • Domain

    Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).
  • Post-translational
    modifications

    Phosphorylation by PKC at Ser-180 reduces conductance by 50%. Phosphorylation by PKG at Ser-111 in response to glutamats increases conductance by 40%.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225651 with 5% enrichment gel and 15% separation gel.

References

ab225651 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up