Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTKKEEPPPSRVPRAVRVASLLSEGEELSGDDQGDEEEDDHAYEGVPNGG WHTSSLSLSLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIY QKRWVRLDTDHLRYFDSNKDAYSKRFISVACISHVAAIGDQKFEVITNNR TFAFRAESDVERKEWMQALQQAMAEQRARARLSSAYLLGVPGSEQPDRAG SLELRGFKNKLYVAVVGDKVQLYKNLEEYHLGIGITFIDMSVGNVKEVDR RSFDLTTPYRIFSFSADSELEKEQWLEAMQGAIAEALSTSEVAERIWAAA PNRFCADCGAPQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRK VWTETLIELFLQLGNGAGNRFWAANVPPSEALQPSSSPSTRRCHLEAKYR EGKYRRYHPLFGNQEELDKALCAAVTTTDLAETQALLGCGAGINCFSGDP EAPTPLALAEQAGQTLQMEFLRNNRTTEVPRLDSMKPLEKHYSVVLPTVS HSGFLYKTASAGKLLQDRRAREEFSRRWCVLGDGVLSYFENERAVTPNGE IRASEIVCLAVPPPDTHGFEHTFEVYTEGERLYLFGLESAEQAHEWVKCI AKAFVPPLAEDLLARDFERLGRLPYKAGLSLQRAQEGWFSLSGSELRAVF PEGPCEEPLQLRKLQELSIQGDSENQVLVLVERRRTLYIQGERRLDFMGW LGAIQKAAASMGDTLSEQQLGDSDIPVIVYRCVDYITQCGLTSEGIYRKC GQTSKTQRLLESLRQDARSVHLKEGEQHVDDVSSALKRFLRDLPDGLFTR AQRLTWLEASEIEDEEEKVSRYRELLVRLPPVNRATVKALISHLYCVQCF SDTNQMNVHNLAIVFGPTLFQTDGQDYKAGRVVEDLINHYVVVFSVDEEE LRKQREEITAIVKMRVAGTASGTQHAGDFICTVYLEEKKAETEQHIKVPA SMTAEELTLEILDRRNVGIREKDYWTCFEVNEREEAERPLHFAEKVLPIL HGLGTDSHLVVKKHQAMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGLP SGGFHDRYFILNSSCLRLYKEVRSQRPWSGAPETSHRPEKEWPIKSLKVY LGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDTQMELREWFATFLFVQ HDGLVWPSEPSRVSRAVPEVRLGSVSLIPLRGSENEMRRSVAAFTADPLS LLRNV
    • Molecular weight

      162 kDa including tags
    • Amino acids

      1 to 1205

Specifications

Our Abpromise guarantee covers the use of ab132003 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2410002L19Rik
    • ANK repeat and PH domain-containing protein 1
    • ARAP 1
    • Arap1
    • ARAP1_HUMAN
    • Arf GAP Rho GAP ankyrin repeat and pleckstrin homology domains containing protein 1
    • Arf GAP Rho GAP ankyrin repeat and pleckstrin homology domain containing protein 1
    • Arf-GAP with Rho-GAP domain
    • CENT D2
    • Centaurin delta 2
    • Centaurin delta2
    • Centaurin-delta-2
    • CENTD 2
    • CENTD2
    • Cnt d2
    • Cnt-d2
    • Cntd2
    • KIAA0782
    • MGC176140
    • mKIAA0782
    see all
  • Function

    Phosphatidylinositol-3,4,5-trisphosphate-dependent GTPase-activating protein that modulates actin cytoskeleton remodeling by regulating ARF and RHO family members. Is activated by phosphatidylinositol-3,4,5-trisphosphate (PtdIns(3,4,5)P3) binding. Can be activated by phosphatidylinositol-3,4-bisphosphate (PtdIns(3,4,5)P2) binding, albeit with lower efficiency. Has a preference for ARF1 and ARF5.
  • Tissue specificity

    Detected in heart, skeletal muscle, spleen, kidney, liver, placenta, lung, peripheral blood leukocytes, adrenal gland, bone marrow, brain, lymph node, mammary gland, prostate, spinal cord, stomach, thyroid and trachea.
  • Sequence similarities

    Contains 1 Arf-GAP domain.
    Contains 4 PH domains.
    Contains 1 Ras-associating domain.
    Contains 1 Rho-GAP domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localization

    Cytoplasm. Golgi apparatus > Golgi stack membrane. Cell membrane. Associated with Golgi stacks in resting cells. Throughout the cytoplasm and in surface protrusion in cells that are in the process of attaching to a surface and spreading.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132003 stained with Coomassie Blue.

References

ab132003 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132003.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up