Overview

  • Product name

    Recombinant Human Arc protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMELDHRTSGGLHAYPGPRGGQVAKPNVILQ IGKCRAEMLEHVRRTHRHLLAEVSKQVERELKGLHRSVGKLESNLDGYVP TSDSQRWKKSIKACLCRCQETIANLERWVKREMHVWREVFYRLERWADRL ESTGGKYPVGSESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAA GELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPREFLSHLEEYLRQ VGGSEEYWLSQIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLS REAIQRELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQ PKLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPAGPHLPVEDEAETLT PAPNSESVASDRTQPE
    • Molecular weight

      47 kDa including tags
    • Amino acids

      1 to 396
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab140728 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab140728 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • activity regulated cytoskeleton associated protein
    • activity regulated gene 3.1 protein homolog
    • Activity-regulated cytoskeleton-associated protein
    • Activity-regulated gene 3.1 protein homolog
    • Arc
    • ARC/ARG3.1
    • ARC_HUMAN
    • Arg 3.1
    • Arg3.1
    see all
  • Function

    Required for consolidation of synaptic plasticity as well as formation of long-term memory. Regulates endocytosis of AMPA receptors in response to synaptic activity. Required for homeostatic synaptic scaling of AMPA receptors (By similarity). Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration.
  • Sequence similarities

    Belongs to the ARC/ARG3.1 family.
  • Cellular localization

    Cytoplasm > cytoskeleton. Endosome. Cytoplasmic vesicle > secretory vesicle > acrosome. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Cell projection > dendrite. Cell projection > dendritic spine. Cell junction > synapse. Associated with the cell cortex of neuronal soma and dendrites. Enriched in postsynaptic density of dendritic spines. Associated with the sperm tail (By similarity). Enriched on the plasma membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab140728 (3µg)..

References

ab140728 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140728.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up