Description

  • Product name

    Recombinant Human ARF6 protein
  • Purity

    > 95 % SDS-PAGE.
    ab102025 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGKVLSKIFGNKEMRILMLGLDAAGKTTIL YKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTG TQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAM KPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
    • Predicted molecular weight

      22 kDa including tags
    • Amino acids

      1 to 175
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.00348% PMSF, 0.0308% DTT, 0.316% Tris HCl, 20% Glycerol

General Info

  • Alternative names

    • ADP ribosylation factor 6
    • ADP ribosylation factor protein 6
    • ADP-ribosylation factor 6
    • ARF6
    • ARF6_HUMAN
    • DKFZp564M0264
    • Small GTP binding protein
    • Small GTPase
    see all
  • Function

    GTP-binding protein involved in protein trafficking; regulates endocytic recycling and cytoskeleton remodeling. May modulate vesicle budding and uncoating within the Golgi apparatus. Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in the regulation of dendritic spine development (By similarity). Contributes to the regulation of dendritic branching and filopodia extension.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Arf family.
  • Cellular localization

    Golgi apparatus. Cell membrane. Endosome membrane. Cell membrane. Cell projection > filopodium membrane. Recruited to the cell membrane in association with CYTH2 and ARL4C.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab102025 (3µg)

References

ab102025 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102025.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up