Description

  • Product name

    Recombinant Human Arg2 protein
    See all Arg2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSLRGSLSRLLQTRVHSILKKSVHSVAVIG APFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDD LYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGH ARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG FSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKV MERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIA EEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGG HIVYDQLPTPSSPDESENQARVRI
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      23 to 354
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature.

Specifications

Our Abpromise guarantee covers the use of ab172173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • ARG2
    • ARGI2_HUMAN
    • Arginase II mitochondrial
    • Arginase type II
    • Arginase-2
    • arginase-2, mitochondrial
    • Kidney arginase
    • Kidney type arginase
    • Kidney-type arginase
    • L arginine amidinohydrolase
    • L arginine ureahydrolase
    • mitochondrial
    • Non hepatic arginase
    • Non-hepatic arginase
    • Nonhepatic arginase
    • Type II arginase
    see all
  • Function

    May play a role in the regulation of extra-urea cycle arginine metabolism and also in down-regulation of nitric oxide synthesis. Extrahepatic arginase functions to regulate L-arginine bioavailability to NO synthase. Since NO synthase is found in the penile corpus cavernosum smooth muscle, the clitoral corpus cavernosum and the vagina, arginase II plays a role in both male and female sexual arousal. It is therefore a potential target for the treatment of male and female sexual arousal disorders.
  • Tissue specificity

    Expressed most strongly in kidney and prostate, much less strongly in the brain, skeletal muscle, placenta, lung, mammary gland, macrophage, uterus, testis and gut, but apparently not in the liver, heart and pancreas.
  • Pathway

    Nitrogen metabolism; urea cycle; L-ornithine and urea from L-arginine: step 1/1.
  • Sequence similarities

    Belongs to the arginase family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab172173.

    Lane 1: Non-reduced

    Lane 2: Reduced

References

ab172173 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up