Description

  • Product name

    Recombinant Human Arg2 protein
    See all Arg2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab97349 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMVHSVAVIGAPFSQGQKRKGVEHGPAAIRE AGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAE VVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTP LTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISASIVYIGLRDVD PPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDI DAFDPTLAPATFTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLA TSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARV RI
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      23 to 354
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab97349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.316% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • ARG2
    • ARGI2_HUMAN
    • Arginase II mitochondrial
    • Arginase type II
    • Arginase-2
    • arginase-2, mitochondrial
    • Kidney arginase
    • Kidney type arginase
    • Kidney-type arginase
    • L arginine amidinohydrolase
    • L arginine ureahydrolase
    • mitochondrial
    • Non hepatic arginase
    • Non-hepatic arginase
    • Nonhepatic arginase
    • Type II arginase
    see all
  • Function

    May play a role in the regulation of extra-urea cycle arginine metabolism and also in down-regulation of nitric oxide synthesis. Extrahepatic arginase functions to regulate L-arginine bioavailability to NO synthase. Since NO synthase is found in the penile corpus cavernosum smooth muscle, the clitoral corpus cavernosum and the vagina, arginase II plays a role in both male and female sexual arousal. It is therefore a potential target for the treatment of male and female sexual arousal disorders.
  • Tissue specificity

    Expressed most strongly in kidney and prostate, much less strongly in the brain, skeletal muscle, placenta, lung, mammary gland, macrophage, uterus, testis and gut, but apparently not in the liver, heart and pancreas.
  • Pathway

    Nitrogen metabolism; urea cycle; L-ornithine and urea from L-arginine: step 1/1.
  • Sequence similarities

    Belongs to the arginase family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab97349 at approximately 38.3kDa (3µg).

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab97349.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up