Description

  • Product name

    Recombinant Human ARHGAP12 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKMADRSGKIIPGQVYIEVEYDYEYEAKDRKIVIKQGERYILVKKTNDDW WQVKPDENSKAFYVPAQYVKEVTRKALMPPVKQVAGLPNNSTKIMQSLHL QRSTENVNKLPELSSFGKPSSSVQGTGLIRDANQNFGPSYNQGQTVNLSL DLTHNNGKFNNDSHSPKVSSQNRTRSFGHFPGPEFLDVEKTSFSQEQSCD SAGEGSERIHQDSESGDELSSSSTEQIRATTPPNQGRPDSPVYANLQELK ISQSALPPLPGSPAIQINGEWETHKDSSGRCYYYNRGTQERTWKPPRWTR DASISKGDFQNPGDQELLSSEENYYSTSYSQSDSQCGSPPRGWSEELDER GHTLYTSDYTNEKWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQRE IIKSRSLDRRLQEPIVLTKWRHSTIVLDTNDKESPTASKPCFPENESSPS SPKHQDTDQEKYGLLNVTKIAENGKKVRKNWLSSWAVLQGSSLLFTKTQG SSTSWFGSNQSKPEFTVDLKGATIEMASKDKSSKKNVFELKTRQGTELLI QSDNDTVINDWFKVLSSTINNQAVETDEGIEEEIPDSPGIEKHDKEKEQK DPKKLRSFKVSSIDSSEQKKTKKNLKKFLTRRPTLQAVREKGYIKDQVFG SNLANLCQRENGTVPKFVKLCIEHVEEHGLDIDGIYRVSGNLAVIQKLRF AVNHDEKLDLNDSKWEDIHVITGALKMFFRELPEPLFTFNHFNDFVNAIK QEPRQRVAAVKDLIRQLPKPNQDTMQILFRHLRRVIENGEKNRMTYQSIA IVFGPTLLKPEKETGNIAVHTVYQNQIVELILLELSSIFGR
    • Predicted molecular weight

      122 kDa including tags
    • Amino acids

      1 to 841

Specifications

Our Abpromise guarantee covers the use of ab132812 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Arhgap12
    • FLJ10971
    • FLJ20737
    • FLJ21785
    • RHG12_HUMAN
    • Rho GTPase activating protein 12
    • Rho GTPase-activating protein 12
    • Rho type GTPase activating protein 12
    • Rho-type GTPase-activating protein 12
    see all
  • Function

    GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
  • Sequence similarities

    Contains 1 PH domain.
    Contains 1 Rho-GAP domain.
    Contains 1 SH3 domain.
    Contains 2 WW domains.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132812 stained with Coomassie Blue.

References

ab132812 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132812.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up