Description

  • Product name

    Recombinant Human ARHGAP29 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KRAWASGQLSTDITTSEMGLKSLSSNSIFDPDYIKELVNDIRKFSHMLLY LKEAIFSDCFKEVIHIRLEELLRVLKSIMNKHQNLNSVDLQNAAEMLTAK
    • Amino acids

      12 to 111
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160478 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Rho GTPase activating protein 29

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ARHGAP 29
    • Arhgap29
    • ARHGAP29 protein
    • MGC166097
    • PARG 1
    • PARG1
    • PTPL1 associated RhoGAP 1
    • PTPL1-associated RhoGAP protein 1
    • RHG29_HUMAN
    • Rho GTPase activating protein 29
    • Rho GTPase activating protein 29 isoform CRA_a
    • Rho GTPase activating protein 29 isoform CRA_b
    • Rho GTPase-activating protein 29
    • Rho-type GTPase-activating protein 29
    see all
  • Function

    GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. Has strong activity toward RHOA, and weaker activity toward RAC1 and CDC42. May act as a specific effector of RAP2A to regulate Rho. In concert with RASIP1, suppresses RhoA signaling and dampens ROCK and MYH9 activities in endothelial cells and plays an essential role in blood vessel tubulogenesis.
  • Tissue specificity

    Widely expressed. Highly expressed in skeletal muscle and heart. Expressed at intermediate level in placenta, liver and pancreas. Weakly expressed in brain, lung and kidney.
  • Sequence similarities

    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 Rho-GAP domain.
  • Information by UniProt

Images

  • ab160478 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160478 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160478.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up