Overview

  • Product name
    Recombinant Human ARHGAP6 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RHADDNISKDGQEVTGNKMTSLNLATIFGPNLLHKQKSSDKEFSVQSSAR AEESTAIIAVVQKMIENYEALFMVPPDLQNEVLISLLETDPDVVDYLLRR KASQSS
    • Amino acids
      531 to 636
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157903 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARHGAP 6
    • Rho GTPase activating protein 6
    • Rho type GTPase activating protein RhoGAPX 1
    • RHOGAP 6
    • RHOGAP6
    • RhoGAPX 1
    • RhoGAPX1
    see all
  • Relevance
    ARHGAP6 (Rho GTPase activating protein 6) is similar to the rhoGAP family of proteins which play a role in the regulation of actin polymerization at the plasma membrane of several cellular processes. ARHGAP6 is thought to have two independent functions, one as a GTPase-activating protein (GAP) with specificity for RhoA and another as a cytoskeletal protein that promotes actin remodeling. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Cellular localization
    Cytoplasmic

Images

  • ab157903 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157903 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157903.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up