Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MENPEEAIYDDVPRENSDSEPDEMIYDDVENGDEGGNSSLEYGWSSSEFE SYEEQSDSECKNGIPRSFLRSNHKKQMQKLVKAAKDGTKDGLERTRAAVK RGRSFIRTKSLIAQDHRSSLEEEQNLFIDVDCKHPEAILTPMPEGLSQQQ VVRRYILGSVVDSEKNYVDALKRILEQYEKPLSEMEPKVLSERKLKTVFY RVKEILQCHSLFQIALASRVSEWDSVEMIGVVFVASFSKSMVLDAYSEYV NNFSTAVAVLKKTCATKPAFLEFLKQEQEASPDRTTLYSLMMKPIQRFPQ FILLLQDMLKNTSKGHPDRLPLQMALTELETLAEKLNERKRDADQRCEVK QIAKAINERYLNKVERGFLQLYSKIIFALC
    • Amino acids
      1 to 380
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160592 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARHGA_HUMAN
    • ARHGEF10
    • DKFZp686H0726
    • GEF10
    • KIAA0294
    • MGC131664
    • Rho guanine nucleotide exchange factor (GEF) 10
    • Rho guanine nucleotide exchange factor 10
    see all
  • Function
    May play a role in developmental myelination of peripheral nerves.
  • Involvement in disease
    Defects in ARHGEF10 are the cause of slowed nerve conduction velocity (SNCV) [MIM:608236]. Affected individuals present a reduction in nerve conduction velocities without any clinical signs of peripheral or central nervous system dysfunction. SNCV inheritance is autosomal dominant.
  • Sequence similarities
    Contains 1 DH (DBL-homology) domain.
  • Information by UniProt

Images

  • ab160592 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160592 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160592.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up