Recombinant Human ARHGEF11 protein (ab160673)

Overview

  • Product name
    Recombinant Human ARHGEF11 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSTSSLS TRSLENPTPPFTPKMGRRSIESPSLGFCTDTLLPHLLEDDLGQLSDLEPE
    • Amino acids
      651 to 750
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160673 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARHGB_HUMAN
    • ARHGEF 11
    • ARHGEF11
    • DKFZp667F1223
    • Glutamate transporter EAAT4 associated protein 48
    • GTRAP 48
    • GTRAP48
    • KIAA0380
    • OTTHUMP00000038716
    • OTTHUMP00000038717
    • PDZ RHOGEF
    • PDZ-RhoGEF
    • Rho guanine exchange factor (GEF) 11
    • Rho guanine nucleotide exchange factor (GEF) 11
    • Rho guanine nucleotide exchange factor 11
    • RhoA specific guanine nucleotide exchange factor
    • RhoGEF glutamate transport modulator
    see all
  • Function
    May play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13). Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase and may act as GTPase-activating protein (GAP) for GNA12 and GNA13.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Contains 1 DH (DBL-homology) domain.
    Contains 1 PDZ (DHR) domain.
    Contains 1 PH domain.
    Contains 1 RGSL (RGS-like) domain.
  • Domain
    The poly-Pro region is essential for plasma membrane localization upon stimulation.
  • Cellular localization
    Cytoplasm. Membrane. Translocated to the membrane upon stimulation.
  • Information by UniProt

Images

  • ab160673 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160673 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160673.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up