Overview

  • Product name
    Recombinant Human ARHGEF5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGGFSRRCSKLINSSQLLYQEYSDVVLNKEIQSQQRLESLSETPGPSSPR QPRKALVSSESYLQRLSMASSGSLWQEIPVVRNSTVLLSMTHEDQKLQEV KFELIVSEASYLRSLNIAVDHFQLSTSLRATLSNQEHQWLFSRLQDVRDV SATFLSDLEENFENNIFSFQVCDVVLNHAPDFRRVYLPYVTNQTYQERTF QSLMNSNSNFREVLEKLESDPVCQRLSLKSFLILPFQRITRLKLLLQNIL KRTQPGSSEEAEATKAHHALEQLIRDCNNNVQSMRRTEELIYLSQKIEFE CKIFPLISQSRWLVKSGELTALEFSASPGLRRKLNTRPVHLHLFNDCLLL SRPREGSRFLVFDHAPFSSIRGEKCEMKLHGPHKNLFRLFLRQNTQGAQA EFLFRTETQSEKLRWISALAMPREELDLLECYNSPQVQCLRAYKPRENDE LALEKADVVMVTQQSSDGWLEGVRLSDGERGWFPVQQVEFISNPEVRAQN LKEAHRVKTAKLQLVEQQA
    • Amino acids
      1 to 519
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARHG5_HUMAN
    • ARHGEF 5
    • ARHGEF5
    • DKFZp686N1969
    • ephexin 3
    • Ephexin-3
    • GEF 5
    • GEF5
    • Guanine nucleotide regulatory protein TIM
    • Oncogene TIM
    • P60
    • p60 TIM
    • Rho guanine nucleotide exchange factor (GEF) 5
    • Rho guanine nucleotide exchange factor 5
    • TIM
    • TIM 1
    • TIM1
    • Transforming immortalized mammary oncogene
    see all
  • Tissue specificity
    Mainly expressed in kidney, liver, pancreas, lung and placenta.
  • Sequence similarities
    Contains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
    Contains 1 SH3 domain.
  • Information by UniProt

Images

  • ab159921 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159921 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up