Overview

  • Product name

    Recombinant Human ARID1A protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAG PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPD SGMYSPSRYP
    • Molecular weight

      38 kDa including tags
    • Amino acids

      1216 to 1325

Specifications

Our Abpromise guarantee covers the use of ab152847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • actin-dependent regulator of chromatin subfamily F member 1
    • ARI1A_HUMAN
    • ARID domain containing protein 1A
    • ARID domain-containing protein 1A
    • ARID1A
    • AT rich interactive domain 1A
    • AT rich interactive domain 1A (SWI like)
    • AT rich interactive domain containing protein 1A
    • AT-rich interactive domain-containing protein 1A
    • B120
    • BAF250
    • BAF250A
    • BM029
    • brain protein 120
    • BRG1 associated factor 250
    • BRG1 associated factor 250a
    • BRG1-associated factor 250
    • BRG1-associated factor 250a
    • C1ORF4
    • chromatin remodeling factor p250
    • chromosome 1 open reading frame 4
    • ELD
    • hELD
    • hOSA1
    • matrix-associated
    • MRD14
    • Osa homolog 1
    • OSA1
    • OSA1 nuclear protein
    • P270
    • SMARCF1
    • SWI like protein
    • SWI SNF complex protein p270
    • SWI-like protein
    • SWI/SNF complex protein p270
    • SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily f, member 1
    • SWI/SNF-related
    see all
  • Function

    Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Binds DNA non-specifically. Also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.
  • Tissue specificity

    Highly expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon, and PBL, and at a much lower level in heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas.
  • Sequence similarities

    Contains 1 ARID domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152847 stained with Coomassie Blue.

References

ab152847 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up