Overview

  • Product name
    Recombinant Human ARID1B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRER MQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR
    • Amino acids
      1364 to 1460
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab163568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6A3 5
    • ARID 1B
    • ARID domain containing protein 1B
    • AT rich interactive domain 1B
    • AT rich interactive domain 1B (SWI1 like)
    • AT rich interactive domain containing protein 1B
    • BAF 250b
    • BAF-associated factor, 250-KD, B
    • BAF250b
    • BRG1 associated factor 250b
    • BRG1 binding protein
    • BRG1 binding protein ELD/OSA1
    • BRG1 binding protein hELD/OSA1
    • BRIGHT
    • DAN 15
    • DAN15
    • Eld (eyelid)/Osa protein
    • ELD/OSA1
    • hELD/OSA1
    • hOsa 2
    • hOsa2
    • KIAA1235
    • MRD12
    • OSA 2
    • Osa homolog 2
    • OSA2
    • OTTHUMP00000040115
    • p250R
    • RP11 419L10.1
    see all
  • Relevance
    ARID1B (AT-rich interactive domain-containing protein 1B) is a component of SWI/SNF chromatin remodeling complexes involved in transcriptional activation and repression of select genes by chromatin remodeling. It binds DNA non-specifically and alters DNA-nucleosome topology.
  • Cellular localization
    Nuclear

Images

  • ab163568 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163568 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up