Overview

  • Product name

    Recombinant Human ARIH2/TRIAD1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQG ADAFDPEEYQFTCLTYKESEGALNEHMTSLASVLKVSHSVAKLILVNFHW QVSEILDRYKSNSAQLLVEARVQPNPSKHVPTSHPPHHCAVCMQFVRKEN LLSLACQHQFCRSCWEQHCSVLVKDGVGVGVSCMAQDCPLRTPEDFVFPL LPNEELREKYRRYLFRDYVESHYQLQLCPGADCPMVIRVQEPRARRVQCN RCNEVFCFKCRQMYHAPTDCATIRKWLTKCADDSETANYISAHTKDCPKC NICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHGSEYYECSRYKENPDIV NQSQQAQAREALKKYLFYFERWENHNKSLQLEAQTYQRIHEKIQERVMNN LGTWIDWQYLQNAAKLLAKCRYTLQYTYPYAYYMESGPRKKLFEYQQAQL EAEIENLSWKVERADSYDRGDLENQMHIAEQRRRTLLKDFHDT
    • Amino acids

      1 to 493
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160984 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as ARIH2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HT005
    • all trans retinoic acid inducible RING finger
    • Ari 2
    • Ari-2
    • ARI2
    • ARI2_HUMAN
    • Ariadne 2
    • Ariadne 2 protein homolog
    • ariadne homolog 2
    • ariadne homolog 2 (Drosophila)
    • Ariadne RBR E3 ubiquitin protein ligase 2
    • ARIH 2
    • Arih2
    • E3 ubiquitin protein ligase ARIH2
    • E3 ubiquitin-protein ligase ARIH2
    • protein ariadne 2 homolog
    • Protein ariadne-2 homolog
    • Triad 1
    • TRIAD1
    • Triad1 protein
    • UIP48
    see all
  • Function

    E3 ubiquitin-protein ligase mediating 'Lys-48'-and 'Lys-63'-linked polyubiquitination and subsequent proteasomal degradation of modified proteins. May play a role in myelopoiesis.
  • Tissue specificity

    Widely expressed with higher expression in granulocytes.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the RBR family. Ariadne subfamily.
    Contains 1 IBR-type zinc finger.
    Contains 2 RING-type zinc fingers.
  • Domain

    RING-type 1 and RING-type 2 are required for the inhibitory function in myelopoiesis.
  • Post-translational
    modifications

    Ubiquitinated. Ubiquitination promotes proteasomal degradation.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • ab160984 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160984 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160984.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up