Description

  • Product name

    Recombinant Human ARL1 protein
  • Purity

    > 95 % SDS-PAGE.
    ab99261 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGGFFSSIFSSLFGTREMRILILGLDGAGK TTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRC YYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDM EQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSR Q
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      1 to 181
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99261 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0308% DTT, 0.316% Tris HCl, 40% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • ADP ribosylation factor like 1
    • ADP-ribosylation factor-like protein 1
    • ARFL1
    • Arl1
    • ARL1_HUMAN
    see all
  • Function

    GTP-binding protein that has very low efficiency as allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Can activate phospholipase D with very low efficiency. Important for normal function of the Golgi apparatus.
  • Tissue specificity

    Detected in heart, liver, lung and liver (at protein level). Detected in fetal heart, lung, liver and kidney. Detected in adult heart, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Arf family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99261 at approximately 22.5kDa (3µg).

References

ab99261 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99261.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up