Description

  • Product name

    Recombinant Human ARL2 protein
  • Purity

    > 90 % SDS-PAGE.
    ab103471 was purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGLLTILKKMKQKERELRLLMLGLDNAGKT TILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNY FESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLP GALSSNAIREALELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRI FTAD
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      1 to 184
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103471 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.00174% PMSF, 0.0154% DTT, 0.316% Tris HCl, 40% Glycerol

General Info

  • Alternative names

    • ADP ribosylation factor like 2
    • ADP-ribosylation factor-like protein 2
    • ARFL2
    • Arl184
    • Arl2
    • ARL2_HUMAN
    see all
  • Function

    Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Regulates formation of new microtubules and centrosome integrity. Prevents the TBCD-induced microtubule destruction. Participates in association with TBCD, in the disassembly of the apical junction complexes. Antagonizes the effect of TBCD on epithelial cell detachment and tight and adherens junctions disassembly. Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. Component of a regulated secretory pathway involved in Ca(2+)-dependent release of acetylcholine. Required for normal progress through the cell cycle.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Arf family.
  • Post-translational
    modifications

    Not N-myristoylated.
  • Cellular localization

    Mitochondrion intermembrane space. Cytoplasm > cytoskeleton > centrosome. Nucleus. Cytoplasm. The complex formed with ARL2BP, ARL2 and SLC25A6 is expressed in mitochondria. The complex formed with ARL2BP, ARL2 and SLC25A4 is expressed in mitochondria (By similarity). Not detected in the Golgi, nucleus and on the mitotic spindle. Centrosome-associated throughout the cell cycle. Not detected to interphase microtubules.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab103471.

References

ab103471 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103471.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up