Description

  • Product name

    Recombinant Human ARL4A protein
  • Purity

    > 90 % SDS-PAGE.
    ab109841 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGNGLSDQTSILSNLPSFQSFHIVILGLDC AGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQE KLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVL IVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLE KLHDMIIKRRKMLRQQKKKR
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      1 to 200
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109841 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • ADP ribosylation factor like 4
    • ADP ribosylation factor like 4A
    • ADP ribosylation factor like GTPase 4A
    • ADP-ribosylation factor-like protein 4A
    • ARL 4
    • ARL4
    • Arl4a
    • ARL4A_HUMAN
    see all
  • Function

    Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in GDP-bound form.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Arf family.
  • Post-translational
    modifications

    Myristoylated.
  • Cellular localization

    Cell membrane. Cytoplasm. Nucleus > nucleolus. Localization in the nucleolus is dependent by nucleotide binding.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab109841 at approximately 24.7kDa (3µg).

References

ab109841 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109841.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up