Description

  • Product name

    Recombinant Human ARL5A protein
  • Purity

    > 90 % SDS-PAGE.
    ab101943 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMGILFTRIWRLFNHQEHKVIIVGLDN AGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSS WNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANK QDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRL KIR
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      1 to 179
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101943 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.00348% PMSF, 0.0308% DTT, 0.316% Tris HCl, 20% Glycerol

General Info

  • Alternative names

    • ADP ribosylation factor like 5
    • ADP ribosylation factor like 5A
    • ADP ribosylation factor like protein 5
    • ADP ribosylation factor like protein 5A
    • ARFLP 5
    • ARFLP5
    • ARL 5
    • ARL 5A
    • ARL5
    see all
  • Relevance

    ARL5A lacks ADP ribosylation enhancing activity.The protein encoded by this gene belongs to the ARF family of GTP binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
  • Cellular localization

    Intracellular

Images

  • 15% SDS-PAGE analysis of 3µg ab101943.

References

ab101943 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101943.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up