Overview

  • Product name

    Recombinant Human ARL6IP1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMG VVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTE QQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAW VGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEK KNE
    • Molecular weight

      48 kDa including tags
    • Amino acids

      1 to 203

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132293 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.

    Previously labelled as ARMER.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ADP ribosylation factor like 6 interacting protein
    • ADP-ribosylation factor-like protein 6-interacting protein 1
    • Aip-1
    • Aip1
    • AR6P1_HUMAN
    • ARL-6-interacting protein 1
    • ARL6 interacting protein 1
    • ARL6IP
    • Arl6ip1
    • ARMER
    • KIAA0069
    see all
  • Function

    May be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.
  • Tissue specificity

    Expressed in all hematopoietic cell lineages, but the highest level of expression is found in early myeloid progenitor cells. Expressed in brain, bone marrow, thymus and lung. Expressed at low level in liver, kidney and spleen. Not detected in heart.
  • Sequence similarities

    Belongs to the ARL6ip family.
  • Developmental stage

    Down-regulated during myeloid differentiation.
  • Cellular localization

    Endomembrane system. Predominantly localized to intracytoplasmic membranes.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132293.

References

ab132293 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132293.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up