Description

  • Product name

    Recombinant Human ARL6IP2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFT EYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQ NQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFK RELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHP KSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDL KEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYA ARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALIFLCTWAYV KYSGEFREIGTVIDQIAETLWEQVLKPLGDNLMEENIRQSVTNSIKAGLT DQVSHHARLKTD
    • Amino acids

      1 to 412
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ADP ribosylation factor like 6 interacting protein 2
    • ADP ribosylation factor like protein 6 interacting protein 2
    • ADP-ribosylation factor-like protein 6-interacting protein 2
    • Aip 2
    • Aip-2
    • Aip2
    • ARL 6 interacting protein 2
    • ARL-6-interacting protein 2
    • ARL3IP2
    • ARL6IP 2
    • ATL 2
    • ATL2
    • ATLA2_HUMAN
    • Atlastin 2
    • Atlastin GTPase 2
    • Atlastin-2
    • Atlastin2
    • FLJ23293
    see all
  • Function

    GTPase tethering membranes through formation of trans-homooligomer and mediating homotypic fusion of endoplasmic reticulum membranes. Functions in endoplasmic reticulum tubular network biogenesis.
  • Tissue specificity

    Expressed in peripheral tissues (at protein level).
  • Sequence similarities

    Belongs to the GBP family. Atlastin subfamily.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab163808 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163808 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163808.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up