Recombinant Human ARMCX1 protein (ab162503)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGRTREAGCVAAGVVIGAGACYCVYRLAWGRDENEKIWDEDEESTDTSEI GVETVKGAKTNAGAGSGAKLQGDSEVKPEVSLGLEDCPGVKEKAHSGSHS GGGLEAKAKALFNTLKEQASAKAGKGARVGTISGNRTLAPSLPCPGGRGG GCHPTRSGSRAGGRASGKSKGKARSKSTRAPATTWPVRRGKFNFPYKIDD ILSAPDLQKVLNILERTNDPFIQEVALVTLGNNAAYSFNQNAIRELGGVP IIAKLIKTKDPIIREKTYNALNNLSVNAENQGKIKTYISQVCDDTMVCRL DSAVQMAGLRLLTNMTVTNHYQHLLSYSFPDFFALLFLGNHFTKIQIMKL IINFTENPAMTRELVSCKVPSELISLFNKEWDREILLNILTLFENINDNI KNEGLASSRKEFSRSSLFFLFKESGVCVKKIKALANHNDLVVKVKVLKVL TKL
    • Amino acids
      1 to 453
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162503 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARMCX 1
    • AD032
    • ALEX1
    • ARM protein lost in epithelial cancers on chromosome X 1
    • Arm protein lost in epithelial cancers X chromosome 1
    • Armadillo repeat containing X linked 1
    • Armadillo repeat containing X linked protein 1
    • Armadillo repeat-containing X-linked protein 1
    • ARMCX1
    • ARMX1_HUMAN
    • Protein ALEX1
    see all
  • Tissue specificity
    Expressed at high levels ovary, heart, testis, prostate, brain, spleen and colon. Expressed at very low levels in liver and thymus. Not expressed in peripheral blood leukocytes. Not or reduced expressed in lung, prostate, colon, pancreas and ovarian carcinomas.
  • Sequence similarities
    Contains 3 ARM repeats.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab162503 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162503 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162503.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up