Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQ FGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKS QE
    • Amino acids
      278 to 379
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162594 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1200004E24Rik
    • ALEX3
    • ARM protein lost in epithelial cancers on chromosome X 3
    • Arm protein lost in epithelial cancers, X chromosome, 3
    • Armadillo repeat containing X linked protein 3
    • dJ545K15.2
    • DKFZp781N1954
    • KIAA0443
    • MGC12199
    see all
  • Relevance
    ARMCX3 belongs to the ALEX family of proteins and contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other members of the ALEX family are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is localized won the X chromosome andtThree transcript variants have been identified.
  • Cellular localization
    Membrane; Single-pass membrane protein

Images

  • ab162594 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162594 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162594.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up