Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHELKE HNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAAT FVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVLSLDW HPNNVLLAAGSCDFKCRVFSAYIKEVDEKPASTPWGSKMPFGQLMSEFGG SGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVSTLKTEFLPLL SVSFVSENSVVAAGHDCCPMLFNYDDRGCLTFVSKLDIPKQSIQRNMSAM ERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTVIDG AMTIWDFKTLESSIQGLRIM
    • Amino acids
      1 to 370
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161040 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Actin binding protein (Schizosaccharomyces pombe sop2 like)
    • Actin related protein 2/3 complex subunit 1A 41kDa
    • Actin-related protein 2/3 complex subunit 1A
    • ARC1A_HUMAN
    • Arc40
    • ARPC1A
    • Epididymis luminal protein 68
    • Epididymis secretory protein Li 307
    • HEL 68
    • HEL S 307
    • SOP2-like protein
    • SOP2Hs
    • SOP2L
    see all
  • Function
    Probably functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.
  • Sequence similarities
    Belongs to the WD repeat ARPC1 family.
    Contains 6 WD repeats.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab161040 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161040 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161040.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up