Description

  • Product name

    Recombinant Human ARPC1B protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWTKVHELKE HNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAAR CVRWAPNENKFAVGSGSRVISICYFEQENDWWVCKHIKKPIRSTVLSLDW HPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSS SCGWVHGVCFSASGSRVAWVSHDSTVCLADADKKMAVATLASETLPLLAL TFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARE RFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGM DGGMSIWDVKSLESALKDLKIK
    • Amino acids

      1 to 372
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as ARP2/3 subunit 1B

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Actin related protein 2/3 complex subunit 1B
    • Actin related protein 2/3 complex subunit 1B 41kDa
    • Actin-related protein 2/3 complex subunit 1B
    • ARC1B_HUMAN
    • ARC41
    • Arp2/3 complex 41 kDa subunit
    • ARP2/3 protein complex subunit p41
    • Arpc1b
    • p40 ARC
    • p41 ARC
    • p41-Arc
    see all
  • Function

    Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.
  • Sequence similarities

    Belongs to the WD repeat ARPC1 family.
    Contains 6 WD repeats.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab153046 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153046 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up