Overview

  • Product name

    Recombinant Human ARSE/ASE protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      GACYGRKVCPCFGEKVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVME RVQQAVWEHQRTLSPVPLQLDRLGNIWRPWLQPCCGPFPLCWCLREDDPQ
    • Amino acids

      490 to 589
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157910 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as ARSE

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ARSE
    • Arylsulfatase E
    • Arylsulfatase E (chondrodysplasia punctata 1)
    • Arylsulfatase E; chondrodysplasia punctata 1
    • ASE
    • CDPX
    • CDPX1
    • CDPXR
    • MGC163310
    • OTTHUMP00000022851
    see all
  • Relevance

    Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix.
  • Cellular localization

    Golgi apparatus, Golgi stack.

Images

  • ab157910 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157910 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157910.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up