Overview

Description

  • Nature

    Recombinant
  • Source

    CHO cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      SLGSAPRSPAPREGPPPVLASPAGHLPGGRTARWCSGRARRPPPQPSRPA PPPPAPPSALPRGGRAARAGGPGSRARAAGARGCRLRSQLVPVRALGLGH RSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCR PTRYEAVSFMDVNSTWRTVDRLSATACGCLG
    • Molecular weight

      19 kDa
    • Amino acids

      40 to 220
    • Additional sequence information

      This product is for the mature full length protein including the propeptide. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab206465 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    ab206465 is suitable for cell culture and in vivo testing. Protein is biologically active. Biological activity of purified artemin was tested in in vitro receptor-dependent cellular morphology change induction assay using U2OS cells expressing Ret and GFRα-3 receptor complex.

  • Applications

    Western blot

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/mg
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 4.5
    Constituents: 0.29% Sodium citrate, 0.87% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Artemin
    • Artn
    • ARTN_HUMAN
    • Enovin
    • EVN
    • NBN
    • Neublastin
    • Neurotrophic factor
    see all
  • Function

    Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain.
  • Tissue specificity

    Ubiquitous. Expressed at high levels in peripheral tissues including prostate, placenta, pancreas, heart, kidney, pituitary gland, lung and testis. Expressed at low levels in the brain.
  • Sequence similarities

    Belongs to the TGF-beta family. GDNF subfamily.
  • Developmental stage

    Expressed during embryogenesis. High level expression seen in fetal kidney and lung while a low level expression seen in the fetal brain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • All lanes : anti-Artemin monoclonal antibody

    Lane 1 : ab206465 (reduced)
    Lane 2 : ab206465 (non-reduced)

    Lysates/proteins at 0.2 µg per lane.


    Antibody recognizes only native conformation, dimeric (non-reduced) Artemin.

  • SDS-PAGE  analysis of ab206465 (2μg):

    Lane 1: reduced conditions

    Lane 2: non-reduced conditions

References

ab206465 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206465.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up