Overview

  • Product name
    Recombinant Human ARTS1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FPQILTLIGRNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQ FSTRTRLEEVKGFFSSLKENGSQLRCVQQTIETIEENIGWMDKNFDKIRV WLQSEKLERM
    • Amino acids
      832 to 941
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162657 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A LAP
    • A-LAP
    • Adipocyte derived leucine aminopeptidase
    • Adipocyte-derived leucine aminopeptidase
    • ALAP
    • Aminopeptidase PILS
    • Aminopeptidase regulator of TNFR1 shedding
    • APPILS
    • ARTS 1
    • ARTS-1
    • Arts1
    • Endoplasmic reticulum aminopeptidase 1
    • Endoplasmic reticulum aminopeptidase associated with antigen processing
    • ERAAP
    • ERAAP1
    • ERAP 1
    • Erap1
    • ERAP1_HUMAN
    • KIAA0525
    • kiaa0525 protein
    • PILS AP
    • PILS-AP
    • PILSA
    • PILSAP
    • Puromycin insensitive leucyl specific aminopeptidase
    • Puromycin-insensitive leucyl-specific aminopeptidase
    • Type 1 tumor necrosis factor receptor shedding aminopeptidase regulator
    • type 1 tumor necrosis factor receptors shedding aminopeptidase regulator
    • VEGF-induced aminopeptidase
    see all
  • Function
    Aminopeptidase that plays a central role in peptide trimming, a step required for the generation of most HLA class I-binding peptides. Peptide trimming is essential to customize longer precursor peptides to fit them to the correct length required for presentation on MHC class I molecules. Strongly prefers substrates 9-16 residues long. Rapidly degrades 13-mer to a 9-mer and then stops. Preferentially hydrolyzes the residue Leu and peptides with a hydrophobic C-terminus, while it has weak activity toward peptides with charged C-terminus. May play a role in the inactivation of peptide hormones. May be involved in the regulation of blood pressure through the inactivation of angiotensin II and/or the generation of bradykinin in the kidney.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the peptidase M1 family.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab162657 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162657 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162657.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up