Overview

  • Product name
    Recombinant Human ARVCF protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALGPDGYSTVDRRERRPR GASSAGEASEKEPLKLDPSRKAPPPGPSRPAVRLVDAVGDAKPQPVDSWV
    • Amino acids
      863 to 962
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157917 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Armadillo repeat gene deletes in velocardiofacial syndrome
    • Armadillo repeat protein
    • Armadillo repeat protein deleted in velo cardio facial syndrome
    • Armadillo repeat protein deleted in velo-cardio-facial syndrome
    • ARVC_HUMAN
    • Arvcf
    • FLJ35345
    • OTTHUMP00000028704
    • OTTHUMP00000198346
    • OTTHUMP00000198347
    • OTTHUMP00000198348
    see all
  • Function
    Involved in protein-protein interactions at adherens junctions.
  • Tissue specificity
    Found in all the examined tissues including heart, brain, liver and kidney. Found at low level in lung.
  • Sequence similarities
    Belongs to the beta-catenin family.
    Contains 10 ARM repeats.
  • Information by UniProt

Images

  • ab157917 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157917 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157917.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up