Description

  • Product name

    Recombinant Human ASAH1 protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QHAPPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAP VLKVIVNSLKNMINTFVPSGKIMQVVDEKLPGLLGNFPGPFEEEMKGIAA VTDIPLGEIISFNIFYELFTICTSIVAEDKKGHLIHGRNMDFGVFLGWNI NNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSL TLNERFSINGGYLGILEWILGKKDVMWIGFLTRTVLENSTSYEEAKNLLT KTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNY DRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYT TLIDVTKGQFETYLRDCPDPCIGW
    • Predicted molecular weight

      59 kDa including tags
    • Amino acids

      22 to 395
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full-length mature chain with N-terminal 6xHis-SUMO tag. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab226446 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • AC
    • ACDase
    • Acid CDase
    • Acid ceramidase
    • Acid ceramidase precursor
    • Acid ceramidase subunit beta
    • Acylsphingosine deacylase
    • ASAH
    • ASAH 1
    • ASAH1
    • ASAH1_HUMAN
    • FLJ21558
    • FLJ22079
    • N acylsphingosine amidohydrolase
    • N acylsphingosine amidohydrolase (acid ceramidase) 1
    • N acylsphingosine amidohydrolase 1
    • N-acylsphingosine amidohydrolase
    • N-acylsphingosine deacylase
    • PHP
    • PHP32
    • Putative 32 kDa heart protein
    • SMAPME
    see all
  • Function

    Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.
  • Tissue specificity

    Broadly expressed with highest expression in heart.
  • Involvement in disease

    Defects in ASAH1 are the cause of Farber lipogranulomatosis (FL) [MIM:228000]; also known as Farber disease (FD). This sphingolipid disease is characterized by subcutaneous lipid-loaded nodules, excruciating pain in the joints and extremities, marked accumulation of ceramide in lysosomes, and death by three years of age.
  • Sequence similarities

    Belongs to the acid ceramidase family.
  • Cellular localization

    Lysosome.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab226446 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226446.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up