Overview

  • Product name

    Recombinant Human ASAM protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSS RHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGR YVWSHVILKVLVRPSKPKCELEGELTEGSDLTLQCESSSGTEPIVYYWQR IREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNEAGKES CVVRVTVQYVQSIGMVDHHHHHH
    • Molecular weight

      25 kDa including tags
    • Amino acids

      19 to 233
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151843 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Lyophilized from a 0.2 µM filtered solution. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • ACAM
    • Adipocyte adhesion molecule
    • Adipocyte specific adhesion molecule
    • ASAM
    • CAR like membrane protein
    • CAR-like membrane protein
    • CLMP
    • CLMP_HUMAN
    • Coxsackie and adenovirus receptor like membrane protein
    • Coxsackie- and adenovirus receptor-like membrane protein
    • Coxsackievirus- and adenovirus receptor-like membrane protein
    • CSBM
    • CSBS
    • CXADR like membrane protein
    • CXADR-like membrane protein
    • FLJ22415
    • PRO363
    • UNQ318
    see all
  • Function

    May be involved in the cell-cell adhesion. May play a role in adipocyte differentiation and development of obesity.
  • Tissue specificity

    Predominantly expressed in epithelial cells within different tissues and in the white adipose tissue. Expressed at high levels in small intestine and placenta, at intermediate levels in the heart, skeletal muscle, colon, spleen, kidney and lung and at low levels in the liver and peripheral blood leukocytes.
  • Sequence similarities

    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Cell junction > tight junction. Cell membrane.
  • Information by UniProt

References

ab151843 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151843.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up