Description

  • Product name

    Recombinant Human ASB5 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LLYAGADVQKGKYWDTPLHAAAQQSSTEIVNLLLEFGADINAKNTELLRP IDVATSSSMVERILLQHEATPSSLYQLCRLCIRSYIGKPRLHLIPQLQLP TLLKNFLQY
    • Amino acids

      220 to 328
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165449 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Ankyrin repeat and SOCS box containing 5
    • Ankyrin repeat and SOCS box protein 5
    • ASB 5
    • SOCS box protein ASB 5
  • Relevance

    ASB5 is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. It may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. It may play a role in the initiation of arteriogenesis.

Images

  • ab165449 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165449 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165449.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up