Overview

  • Product name

    Recombinant Human ASB6 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPFLHGFRRIIFEYQPLVDAIPGSLGIQDPERQESLDRPSYVASEESRIL VLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDP VTYYTALHIAVLRNQPDMVELLVHHGADVNRRDREKLLCSMLWPAATGCR STILRTFVSYWKEGQTSRPPPKMGTQCSPASSSCLVRPWEGTKRRPR
    • Molecular weight

      47 kDa including tags
    • Amino acids

      1 to 197

Specifications

Our Abpromise guarantee covers the use of ab132747 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Ankyrin repeat and SOCS box containing 6
    • Ankyrin repeat and SOCS box protein 6
    • ASB 6
    • ASB-6
    • ASB6
    • ASB6_HUMAN
    • FLJ20548
    • MGC1024
    see all
  • Function

    Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 6 ANK repeats.
    Contains 1 SOCS box domain.
  • Domain

    The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin-protein ligase complexes.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab132747 on 12.5% SDS-PAGE stained with Coomassie blue.

References

ab132747 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132747.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up