Description

  • Product name

    Recombinant Human ASH1L protein
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHEVARAARLAQIFKEICDGIISYKDSSRQALAAPLLNLPPKKKN ADYYEKISD PLDLITIEKQILTGYYKTVEAFDADMLKVFRNAEKYYGR KSPVGRDVCRLRKAYYNAR HEASAQ
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      2433 to 2548
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab195166 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as KMT2H / ASH1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.64% Tris HCl, 0.63% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol

General Info

  • Alternative names

    • Absent small and homeotic disks protein 1 homolog
    • Absent Small or Homeotic Like
    • ASH 1
    • ASH 1L
    • ash1 (absent small or homeotic 1)
    • Ash1 (absent small or homeotic) like
    • ASH1-like protein
    • ASH1L
    • ASH1L_HUMAN
    • ASH1L1
    • FLJ10504
    • huASH1
    • KIAA1420
    • KMT2H / ASH1
    • Lysine N-methyltransferase 2H
    • Probable histone-lysine N-methyltransferase ASH1L
    see all
  • Function

    Histone methyltransferase. Probably methylates 'Lys-4' of histone H3, a specific tag for epigenetic transcriptional activation.
  • Tissue specificity

    Widely expressed, with highest level in brain, heart and kidney.
  • Sequence similarities

    Belongs to the histone-lysine methyltransferase family. SET2 subfamily.
    Contains 3 A.T hook DNA-binding domains.
    Contains 1 AWS domain.
    Contains 1 BAH domain.
    Contains 1 bromo domain.
    Contains 1 PHD-type zinc finger.
    Contains 1 post-SET domain.
    Contains 1 SET domain.
  • Cellular localization

    Nucleus. Cell junction > tight junction. Chromosome. The relevance of tight junction localization is however unclear.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE using 2.7 µg ab195166 (lane 1). Lane 2 is protein marker.

References

ab195166 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab195166.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up