Description

  • Product name

    Recombinant Human ASH2L protein
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSF HCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDK DIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSK DPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKG RGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYIL AEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKIS DDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLG NLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPED TETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYK NGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMS DMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP
    • Predicted molecular weight

      60 kDa
    • Amino acids

      96 to 628

Specifications

Our Abpromise guarantee covers the use of ab176944 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names

    • ASH 2
    • ASH2
    • Ash2 (absent small or homeotic) like
    • Ash2 (absent, small, or homeotic) like (Drosophila)
    • ASH2 LIKE
    • ASH2 like protein
    • ASH2-like protein
    • Ash2l
    • ASH2L_HUMAN
    • ASH2L1
    • ASH2L2
    • Bre 2
    • Bre2
    • Discs 2-like
    • Drosophila absent, small, or homeotic
    • Drosophila ASH2-like
    • Set1/Ash2 histone methyltransferase complex subunit ASH2
    see all
  • Function

    Component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. May function as a transcriptional regulator. May play a role in hematopoiesis.
  • Tissue specificity

    Ubiquitously expressed. Predominantly expressed in adult heart and testis and fetal lung and liver, with barely detectable expression in adult lung, liver, kidney, prostate, and peripheral leukocytes.
  • Sequence similarities

    Contains 1 B30.2/SPRY domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab176944.

    Lane 1; 1 µg

    Lane 2; 2 µg

    Lane 3; 4 µg

    Lane 4; 6 µg

References

ab176944 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176944.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up