Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQE IKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRF LAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
    • Molecular weight
      42 kDa including tags
    • Amino acids
      1231 to 1374
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152525 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Apoptosis signal regulating kinase 1
    • Apoptosis signal-regulating kinase 1
    • ASK 1
    • ASK-1
    • ASK1
    • M3K5
    • M3K5_HUMAN
    • MAP/ERK kinase kinase 5
    • MAP3K5
    • MAPK/ERK kinase kinase 5
    • MAPKKK5
    • MEK kinase 5
    • MEKK 5
    • MEKK5
    • Mitogen activated protein kinase kinase kinase 5
    • Mitogen-activated protein kinase kinase kinase 5
    see all
  • Function
    Component of a protein kinase signal transduction cascade. Phosphorylates and activates MAP2K4 and MAP2K6, which in turn activate the JNK and p38 MAP kinases, respectively. Overexpression induces apoptotic cell death.
  • Tissue specificity
    Abundantly expressed in heart and pancreas.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Dephosphorylated and activated by PGAM5.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152525 stained with Coomassie Blue.

References

ab152525 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152525.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up