Overview

  • Product name
    Recombinant Human Astrin protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMKN EKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRG CKELQGLLEF
    • Amino acids
      1082 to 1191
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161072 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Astrin
    • Deepest
    • hMAP 126
    • hMAP126
    • MAP 126
    • MAP126
    • Mitotic spindle associated protein
    • Mitotic spindle associated protein p126
    • Mitotic spindle coiled coil related protein
    • Mitotic spindle-associated protein p126
    • SPAG 5
    • SPAG5
    • SPAG5_HUMAN
    • Sperm associated antigen 5
    • Sperm tail protein Spag 5
    • Sperm tail protein Spag5
    • Sperm-associated antigen 5
    see all
  • Function
    Essential component of the mitotic spindle required for normal chromosome segregation and progression into anaphase. Required for chromosome alignment, normal timing of sister chromatid segregation, and maintenance of spindle pole architecture. The astrin (SPAG5)-kinastrin (SKAP) complex promotes stable microtubule-kinetochore attachments.
  • Tissue specificity
    Highly expressed in testis. Detected at low levels in placenta, liver, pancreas, thymus and colon.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton > spindle. Cytoplasm > cytoskeleton > spindle pole. Chromosome > centromere > kinetochore. In a punctate pattern in interphase cells. During mitosis, detected at spindle poles during prophase, throughout the spindle in metaphase and anaphase, and at midzone microtubules in anaphase and telophase. Detected on kinetochores of chromosomes that have congressed. The astrin (SPAG5)-kinastrin (SKAP) complex localizes to the microtubule plus ends.
  • Information by UniProt

Images

  • ab161072 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161072 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161072.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up