Description

  • Product name

    Recombinant Human ASXL1 protein
  • Purity

    > 95 % SDS-PAGE.
    Purity is determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSKANFGASHSASLSLQMFTD SSTVESISLQCACSLKAMIMCQGCGAFCHDDCIGPSKLCVLCLVVR
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      1477 to 1541
    • Tags

      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185833 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS. After reconstitution aliquot and store at < -20 degrees, avoid freeze/thaw cycles.

General Info

  • Alternative names

    • Additional sex combs like 1 (Drosophila)
    • Additional sex combs like protein 1
    • Additional sex combs-like protein 1
    • ASXL1
    • ASXL1_HUMAN
    • KIAA0978
    • Putative Polycomb group protein ASXL1
    see all
  • Function

    Probable Polycomb group (PcG) protein. Non-catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1).
  • Tissue specificity

    Widely expressed at low level. Expressed in heart, brain, skeletal muscle, placenta, pancreas, spleen, prostate, small intestine, colon, peripheral blood, leukocytes, bone marrow and fetal liver. Highly expressed in testes.
  • Sequence similarities

    Belongs to the Asx family.
    Contains 1 PHD-type zinc finger.
  • Domain

    Contains one Leu-Xaa-Xaa-Leu-Leu (LXXLL) motif, which may be required for an association with nuclear receptors.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab185833 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185833.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up