Description

  • Product name

    Recombinant Human ATAD2 protein
    See all ATAD2 proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRA CALRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPK QNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIK KRRKISQAKDDSQNAIDHKIESDTEETQDTSVDHNETGNTGESSVEENEK QQNASESKLELRNNSNTCNIENELEDSRKTTACTELRDKIACNGDASSSQ IIHISDENEGKEMCVLRMTRARRSQVEQQQLITVEKALAILSQPTPSLVV DHERLKNLLKTVVKKSQNYNIFQLENLYAVISQCIYRHRKDHDKTSLIQK MEQEVENFSCSR
    • Amino acids

      1 to 362
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153302 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AAA nuclear coregulator cancer-associated protein
    • AAA nuclear coregulator, cancer-associated
    • ANCCA
    • Atad2
    • ATAD2_HUMAN
    • ATPase family AAA domain containing 2
    • ATPase family AAA domain containing protein 2
    • ATPase family AAA domain-containing protein 2
    • CT137
    • DKFZp667N1320
    • L16
    • MGC131938
    • MGC142216
    • MGC29843
    • MGC5254
    • PRO2000
    see all
  • Function

    May be a transcriptional coactivator of the nuclear receptor ESR1 required to induce the expression of a subset of estradiol target genes, such as CCND1, MYC and E2F1. May play a role in the recruitment or occupancy of CREBBP at some ESR1 target gene promoters. May be required for histone hyperacetylation. Involved in the estrogen-induced cell proliferation and cell cycle progression of breast cancer cells.
  • Tissue specificity

    Highly expressed in estrogen receptor positive breast tumors and in osteosarcoma tumors.
  • Sequence similarities

    Belongs to the AAA ATPase family.
    Contains 1 bromo domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab153302 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153302 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153302.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up