Recombinant human ATAD2B protein (ab198150)

Description

  • Product name

    Recombinant human ATAD2B protein
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGA VLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGD HVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLK SSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEDQEE NTLREL RLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKID KHNYL TAKDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHA IIAAELDPEFNKLCEEIK E
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      953 to 1080
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_017552.

Specifications

Our Abpromise guarantee covers the use of ab198150 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.48% Tris, 0.02% Potassium chloride, 20% Glycerol, 0.64% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • AAA nuclear coregulator cancer-associated protein
    • ANCCA
    • ATAD2
    • ATAD2B
    • ATD2B_HUMAN
    • ATPase family AAA domain containing 2B
    • ATPase family AAA domain containing protein 2B
    • ATPase family AAA domain-containing protein 2
    • ATPase family AAA domain-containing protein 2B
    • KIAA1240
    • L16
    • PRO2000
    see all
  • Sequence similarities

    Belongs to the AAA ATPase family.
    Contains 1 bromo domain.
  • Information by UniProt

Images

  • Specific activity of ab198150.

  • 4-20% SDS-PAGE analysis of ab198150 (2μg) with Coomassie staining.

References

ab198150 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198150.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up