Description

  • Product name

    Recombinant Human ATAD3B protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSWLFGVNKGPKGEGAGPPPPLPPAQPGAEGGGDRGLGDRPAPKDKWSNF DPTGLERAAKAARELEHSRYAKEALNLAQMQEQTLQLEQQSKLKEYEAAV EQLKSEQIRAQAEERRKTLSEETRQHQARAQYQDKLARQRYEDQLKQQRL LNEENLRKQEESVQKQEAMRRATVEREMELRHKNEMLRVETEARARAKAE RENADIIREQIRLKASEHRQTVLESIRTAGTLFGEGFRAFVTDRDKVTAT VAGLTLLAVGVYSAKNATAVTGRFIEARLGKPSLVRETSRITVLEALRHP IQVSRRLLSRPQDVLEGVVLSPSLEARVRDIAIATRNTKKNRGLYRHILL YGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWAN TSRRGLLLFMDEADAFLRKRATEEISKDLRATLNAFLYHMGQHSNKFMLV LASNLPEQFDCAINSRIDVMVHFDLPQQEERERLVRLHFDNCVLKPATEG KRRLKLAQFDYGRKCSEVARLTEGMSGREIAQLAVSWQATAYASKDGVLT EAMMDACVQDAVQQYRQKMRWLKAEGPGRGVEHPLSGVQGETLTSWSLAT DPSYPCLAGPCTFRICSWMGTGLCPGPLSPRMSCGGGRPFCPPGHPLL
    • Amino acids

      1 to 648
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164451 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AAA ATPase TOB3
    • AAA-TOB3
    • ATPase family AAA domain containing protein 3B
    • ATPase family, AAA domain containing 3A
    • ATPase family, AAA domain containing 3B
    • ATPase family, AAA domain containing, member 3B
    • TOB3
    see all
  • Relevance

    ATAD3B belongs to the AAA ATPase family. ATPases are a class of enzymes that catalyze the decomposition of adenosine triphosphate (ATP) into adenosine diphosphate (ADP) and a free phosphate ion. This dephosphorylation reaction releases energy, which the enzyme (in most cases) harnesses to drive other chemical reactions that would not otherwise occur. There are three named isoforms.

Images

  • ab164451 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164451 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164451.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up