Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAAN ETYENNFDNLDFDLDLVPWESDIWDINNQICTVKDIKAEPQPLSPASSSY SVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKE DKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTISSIPP QT
    • Molecular weight

      49 kDa including tags
    • Amino acids

      1 to 202
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab131846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Glutathione is reduced

General Info

  • Alternative names

    • Activating transcription factor 6
    • Activating transcription factor 6 alpha
    • ATF 6
    • ATF6
    • ATF6 alpha
    • ATF6-alpha
    • ATF6A
    • ATF6A_HUMAN
    • cAMP dependent transcription factor ATF 6 alpha
    • cAMP-dependent transcription factor ATF-6 alpha
    • Cyclic AMP dependent transcription factor ATF 6 alpha
    • DKFZp686P2194
    • ESTM49
    • FLJ21663
    • Processed cyclic AMP dependent transcription factor ATF 6 alpha
    • Processed cyclic AMP-dependent transcription factor ATF-6 alpha
    see all
  • Function

    Transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein response target genes. Binds DNA on the 5'-CCAC[GA]-3'half of the ER stress response element (ERSE) (5'-CCAAT-N(9)-CCAC[GA]-3') and of ERSE II (5'-ATTGG-N-CCACG-3'). Binding to ERSE requires binding of NF-Y to ERSE. Could also be involved in activation of transcription by the serum response factor.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the bZIP family. ATF subfamily.
    Contains 1 bZIP domain.
  • Domain

    The basic domain functions as a nuclear localization signal.
    The basic leucine-zipper domain is sufficient for association with the NF-Y trimer and binding to ERSE.
  • Post-translational
    modifications

    During unfolded protein response an approximative 50 kDa fragment containing the cytoplasmic transcription factor domain is released by proteolysis. The cleavage seems to be performed sequentially by site-1 and site-2 proteases.
    N-glycosylated. The glycosylation status may serve as a sensor for ER homeostasis, resulting in ATF6 activation to trigger the unfolded protein response (UPR).
    Phosphorylated in vitro by MAPK14/P38MAPK.
  • Cellular localization

    Endoplasmic reticulum membrane and Nucleus. Under ER stress the cleaved N-terminal cytoplasmic domain translocates into the nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab131846 at approximately 48.5 kDa.

References

ab131846 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up