Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQI KNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHV LYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQ QEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYIT
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 190
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172156 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Additional notes

    Previously labelled as Apg10. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 99% PBS, 0.88% Sodium chloride

    Supplied as a 0.2 µM filtered solution.

General Info

  • Alternative names
    • Apg 10
    • APG 10L
    • APG10
    • APG10 autophagy 10 like
    • APG10 like
    • APG10, S. cerevisiae, homolog of
    • APG10-like
    • APG10L
    • ATG 10
    • ATG10
    • ATG10 autophagy related 10 homolog
    • ATG10 autophagy related 10 homolog (S. cerevisiae)
    • ATG10_HUMAN
    • autophagy 10, S. cerevisiae, homolog of
    • Autophagy related protein 10
    • Autophagy-related protein 10
    • DKFZP586I0418
    • FLJ13954
    • pp12616
    • Ubiquitin-like-conjugating enzyme ATG10
    see all
  • Function
    E2-like enzyme involved in autophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for autophagy. Likely serves as an ATG5-recognition molecule. Not involved in ATG12 conjugation to ATG3 (By similarity). Plays a role in adenovirus-mediated cell lysis.
  • Sequence similarities
    Belongs to the ATG10 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab172156 under reducing (Lane 1) and non reducing conditions (Lane 2)

References

ab172156 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172156.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up