Description

  • Product name

    Recombinant Human ATG14L protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASPSGKGARALEAPGCGPRPLARDLVDSVDDAEGLYVAVERCPLCNTTR RRLTCAKCVQSGDFVYFDGRDRERFIDKKERLSRLKSKQEEFQKEVLKAM EGKWITDQLRWKIMSCKMRIEQLKQTICKGNEEMEKNSEGLLKTKEKNQK LYSRAQRHQEKKEKIQRHNRKLGDLVEKKTIDLRSHYERLANLRRSHILE LTSVIFPIEEVKTGVRDPADVSSESDSAMTSSTVSKLAEARRTTYLSGRW VCDDHNGDTSISITGPWISLPNNGDYSAYYSWVEEKKTTQGPDMEQSNPA YTISAALCYATQLVNILSHILDVNLPKKLCNSEFCGENLSKQKFTRAVKK LNANILYLCFSQHVNLDQLQPLHTLRNLMYLVSPSSEHLGRSGPFEVRAD LEESMEFVDPGVAGESDESGDERVSDEETDLGTDWENLPSPRFCDIPSQS VEVSQSQSTQASPPIASSSAGGMISSAAASVTSWFKAYTGHR
    • Predicted molecular weight

      60 kDa including tags
    • Amino acids

      1 to 492
    • Tags

      His tag N-Terminus
    • Additional sequence information

      10xHis tag at the N-terminus and a Myc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab225977 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • 4832427M01
    • ATG14
    • Atg14L
    • Autophagy-related protein 14-like protein
    • BAKOR_HUMAN
    • Barkor
    • Beclin 1-associated autophagy-related key regulator
    • D14Ertd114e
    • D14Ertd436e
    • KIAA0831
    • mCG_6911
    see all
  • Function

    Required for both basal and inducible autophagy. Plays a role in autophagosome formation and MAP1LC3/LC3 conjugation to phosphatidylethanolamine. Promotes BECN1 translocation from the trans-Golgi network to autophagosomes. Enhances PIK3C3 activity in a BECN1-dependent manner.
  • Sequence similarities

    Belongs to the Barkor family.
  • Domain

    The coiled-coil domain is required for BECN1- and PIK3C3-binding and for autophagy.
  • Cellular localization

    Cytoplasm. Endoplasmic reticulum. Cytosolic under nutrient-rich conditions. Following autophagy stimuli, such as starvation or rapamycin induction, predominantly detected in cytoplasmic foci, identified as isolation membranes and autophagosomes.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225977 with 5% enrichment gel and 15% separation gel.

References

ab225977 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225977.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up