Overview

  • Product name

    Recombinant Human ATG16L1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAEC LQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTT EENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPV EQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFG RRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGS RLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAA SNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKL WDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVRE MELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCG SDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVA WSPSGSHVVSVDKGCKAVLWAQY
    • Molecular weight

      85 kDa including tags
    • Amino acids

      85 to 607

Specifications

Our Abpromise guarantee covers the use of ab132520 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

General Info

  • Alternative names

    • A16L1_HUMAN
    • APG16 like 1
    • APG16-like 1
    • APG16L
    • APG16L beta
    • ATG16 autophagy related 16 like 1
    • ATG16 autophagy related 16-like 1 (S. cerevisiae)
    • ATG16A
    • ATG16L
    • Atg16l1
    • Autophagy related protein 16 1
    • Autophagy-related protein 16-1
    • FLJ00045
    • FLJ10035
    • FLJ10828
    • FLJ22677
    • IBD10
    • OTTHUMP00000164391
    • OTTHUMP00000164393
    • OTTHUMP00000165876
    • OTTHUMP00000165877
    • WD repeat domain 30
    • WDR30
    see all
  • Function

    Plays an essential role in autophagy: interacts with ATG12-ATG5 to mediate the conjugation of phosphatidylethanolamine (PE) to LC3 (MAP1LC3A, MAP1LC3B or MAP1LC3C), to produce a membrane-bound activated form of LC3 named LC3-II. Thereby, controls the elongation of the nascent autophagosomal membrane.
  • Involvement in disease

    Inflammatory bowel disease 10
  • Sequence similarities

    Belongs to the WD repeat ATG16 family.
    Contains 7 WD repeats.
  • Post-translational
    modifications

    Proteolytic cleavage by activated CASP3 leads to degradation and may regulate autophagy upon cellular stress and apoptotic stimuli.
  • Cellular localization

    Cytoplasm. Preautophagosomal structure membrane. Recruited to omegasomes membranes by WIPI2. Omegasomes are endoplasmic reticulum connected strutures at the origin of preautophagosomal structures. Localized to preautophagosomal structure (PAS) where it is involved in the membrane targeting of ATG5. Localizes also to discrete punctae along the ciliary axoneme.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132520 stained with Coomassie Blue.

References

ab132520 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132520.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up